Rapgef2 Rabbit Polyclonal Antibody

CAT#: TA329531

Rabbit Polyclonal Anti-Rapgef2 Antibody

Product Images

Host: Rabbit; Target Name: Rapgef2; Sample Tissue: Mouse Brain lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Rapgef2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rapgef2. Synthetic peptide located within the following region: GHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQSRA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 164 kDa
• Gene Name: Rap guanine nucleotide exchange factor (GEF) 2
• Database Link:
  NP_001093094
  Entrez Gene 9693 HumanEntrez Gene 76089 Mouse
• Background: Rapgef2 is a Guanine nucleotide exchange factor (GEF) for Rap1, Rap1B and Rap2 GTPases.
• Synonyms: CNrasGEF; DKFZP586O1422; KIAA0313; NRAPGEP; PDZ-GEF1; PDZGEF1; RA(Ras/Rap1A-associating)-GEF; RA-GEF; Rap-GEP
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 79%