Hdac3 Rabbit Polyclonal Antibody

CAT#: TA329535

Rabbit Polyclonal anti-Hdac3 antibody

Product Images

WB Suggested Anti-Hdac3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Rat Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Hdac3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: DVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: histone deacetylase 3
• Database Link:
  NP_445900
  Entrez Gene 84578 Rat
  UniProt ID Q6P6W3
• Background: Hdac3 is responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.Hdac3 is required to repress transcription of the POU1F1 transcription factor. Hdac3 acts as a molecular chaperone for shuttling phosphorylated NR2C1 to PML bodies for sumoylation.
• Synonyms: HD3; RPD3; RPD3-2; SMAP45
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 83%