Rgs18 Rabbit Polyclonal Antibody
Other products for "Rgs18"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Rgs18 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AKEKRNRLSLLLQRPDFHGETQASRSALLAKETRVSPEEAVKWAESFDKL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 27 kDa |
Gene Name | regulator of G-protein signaling 18 |
Database Link | |
Background | Rgs18 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Rgs18 binds to G(i) alpha-1, G(i) alpha-2, G(i) alpha-3 and G(q) alpha. |
Synonyms | RGS13 |
Note | Immunogen sequence homology: Mouse: 100%; Rat: 86% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.