Rgs18 Rabbit Polyclonal Antibody

CAT#: TA329546

Rabbit Polyclonal anti-Rgs18 antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Rgs18"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Rgs18 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AKEKRNRLSLLLQRPDFHGETQASRSALLAKETRVSPEEAVKWAESFDKL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 27 kDa
Gene Name regulator of G-protein signaling 18
Background Rgs18 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Rgs18 binds to G(i) alpha-1, G(i) alpha-2, G(i) alpha-3 and G(q) alpha.
Synonyms RGS13
Note Immunogen sequence homology: Mouse: 100%; Rat: 86%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.