Rgs10 Rabbit Polyclonal Antibody

CAT#: TA329547

Rabbit Polyclonal anti-Rgs10 antibody

Product Images

WB Suggested Anti-Rgs10 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Mouse Thymus

• 

  FACS -- Sample type: Bone marrow derived monocytes from mice BV2 cellsDilution: 1ug/mL

Specifications

Product Data

• Applications: FC, WB
• Recommended Dilution: WB, FACS
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rgs10 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MFTRAVSRLSRKRPPSDIHDGDGSSSSGHQSLKSTAKWASSLENLLEDPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: regulator of G-protein signalling 10
• Database Link:
  NP_080694
  Entrez Gene 67865 Mouse
  UniProt ID Q9CQE5
• Background: Rgs10 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Rgs10 associates specifically with the activated forms of the G protein subunits G(i)-alpha and G(z)-alpha but fails to interact with the structurally and functionally distinct G(s)-alpha subunit. Activity of Rgs10 on G(z)-alpha is inhibited by palmitoylation of the G-protein.
• Synonyms: RGS10
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 93%; Human: 93%; Bovine: 93%