PAR6 (PARD6A) Rabbit Polyclonal Antibody

CAT#: TA329553

Rabbit Polyclonal anti-PARD6A antibody

Product Images

WB Suggested Anti-PARD6A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PARD6A antibody: synthetic peptide directed towards the N terminal of human PARD6A. Synthetic peptide located within the following region: MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: par-6 family cell polarity regulator alpha
• Database Link:
  NP_001032358
  Entrez Gene 56513 MouseEntrez Gene 50855 Human
  UniProt ID Q9NPB6
• Background: This gene is a member of the PAR6 family and encodes a protein with a PSD95/Discs-large/ZO1 (PDZ) domain and a semi-Cdc42/Rac interactive binding (CRIB) domain. This cell membrane protein is involved in asymmetrical cell division and cell polarization processes as a member of a multi-protein complex. The protein also has a role in the epithelial-to-mesenchymal transition (EMT) that characterizes the invasive phenotype associated with metastatic carcinomas. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Synonyms: PAR-6A; PAR6; PAR6alpha; PAR6C; TAX40; TIP-40
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Endocytosis, Tight junction