Prkn Rabbit Polyclonal Antibody

CAT#: TA329563

Rabbit Polyclonal anti-Park2 antibody

Product Images

WB Suggested Anti-Park2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Mouse Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Park2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YTRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEQGQRKVTCEGGNGLGCG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: Parkinson disease (autosomal recessive, juvenile) 2, parkin
• Database Link:
  NP_057903
  Entrez Gene 50873 Mouse
  UniProt ID Q9WVS6
• Background: Park2 functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. These substrates include SYT11, CCNE1, GPR37, STUB1, a 22 kDa O-linked glycosylated isoform of SNCAIP, SEPT5 and AIMP2. Park2 may play a more general role in the ubiquitin proteasomal pathway by participating in the removal and/or detoxification of abnormally folded or damaged protein. Park2 limits the production of reactive oxygen species (ROS). Loss of this ubiquitin ligase activity appears to be the mechanism underlying pathogenesis of AR-JP. Park2 may protect neurons against alpha synuclein toxicity, proteasomal dysfunction, GPR37 accumulation, and kainate-induced excitotoxicity. Park2 may play a role in controlling neurotransmitter trafficking at the presynaptic terminal and in calcium-dependent exocytosis. Park2 regulates cyclin E during neuronal apoptosis. Park2 may represent a tumor suppressor gene. Park2 promotes the autophagic degradation of dysfunctional depolarized mitochondria.
• Synonyms: AR-JP; LPRS2; parkin; PDJ; PRKN
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Bovine: 92%; Dog: 86%; Rat: 86%; Mouse: 86%