MTFMT Rabbit Polyclonal Antibody

CAT#: TA329581

Rabbit polyclonal anti-MTFMT antibody

Product Images

WB Suggested Anti-MTFMT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Fetal Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MTFMT antibody: synthetic peptide directed towards the C terminal of human MTFMT. Synthetic peptide located within the following region: SVMLKKSLTATDFYNGYLHPWYQKNSQAQPSQCRFQTLRLPTKKKQKKTV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: mitochondrial methionyl-tRNA formyltransferase
• Database Link:
  NP_640335
  Entrez Gene 123263 Human
  UniProt ID Q96DP5
• Background: MTFMT formylates methionyl-tRNA in mitochondria. A single tRNA(Met) gene gives rise to both an initiator and an elongator species via an unknown mechanism.
• Synonyms: COXPD15; FMT1
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Bovine: 92%; Rat: 86%; Mouse: 83%; Rabbit: 79%

Reference Data

• Protein Pathways: Aminoacyl-tRNA biosynthesis, One carbon pool by folate