Germany
Japan
United Kingdom
China
Bola2 Rabbit Polyclonal Antibody
Product Images
Other products for "Bola2"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Mouse |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Bola2 antibody: synthetic peptide directed towards the n terminal of mouse Bola2. Synthetic peptide located within the following region: MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLL |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 10 kDa |
| Gene Name | bolA-like 2 (E. coli) |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | BOLA2A; My016 |
| Note | Immunogen sequence homology: Rat: 100%; Mouse: 100%; Goat: 86%; Human: 86%; Bovine: 86%; Rabbit: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.