Mkx Rabbit Polyclonal Antibody

CAT#: TA329618

Rabbit polyclonal anti-Mkx Antibody

Product Images

Host: Rabbit; Target Name: Mkx; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Mkx antibody is: synthetic peptide directed towards the C-terminal region of Mouse Mkx. Synthetic peptide located within the following region: SNEFEEELVSPSSSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: mohawk homeobox
• Database Link:
  NP_808263
  Entrez Gene 210719 Mouse
  UniProt ID Q8BIA3
• Background: The function of this protein remains unknown.
• Synonyms: C10orf48; IFRX; IRXL1; MGC39616; OTTHUMP00000019374
• Note: Immunogen sequence homology: Mouse: 100%