Foxn2 Rabbit Polyclonal Antibody

CAT#: TA329632

Rabbit polyclonal anti-Foxn2 antibody

Product Images

WB Suggested Anti-Foxn2 Antibody Titration: 0.0625 ug/ml; ELISA Titer: 1:12500; Positive Control: Mouse Spleen

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Foxn2 antibody: synthetic peptide directed towards the n terminal of mouse Foxn2. Synthetic peptide located within the following region: KRAETPGAEKVAGLSQIYKMGSLPEAGDAARPKATLVGSESADDELTNLN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 23 kDa
• Gene Name: forkhead box N2
• Database Link:
  NP_851305
  Entrez Gene 14236 Mouse
• Background: The function of this protein remains unknown.
• Synonyms: HTLF
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Human: 93%; Rabbit: 93%; Bovine: 86%