MINA53 (MINA) Rabbit Polyclonal Antibody

CAT#: TA329646

Rabbit Polyclonal anti-MINA Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RIOX2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-MINA antibody is: synthetic peptide directed towards the C-terminal region of Human MINA. Synthetic peptide located within the following region: LTVLPDQDQSDEAQEKMVYIYHSLKNSRETHMMGNEEETEFHGLRFPLSH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 23 kDa
Gene Name MYC induced nuclear antigen
Background MINA is a c-Myc target gene that may play a role in cell proliferation or regulation of cell growth.
Synonyms MDIG; MINA53; NO52; ROX
Note Immunogen sequence homology: Human: 100%; Rabbit: 93%; Rat: 86%; Dog: 79%; Pig: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.