Germany
Japan
United Kingdom
China
ZMAT1 Rabbit Polyclonal Antibody
CAT#: TA329660
Rabbit Polyclonal anti-ZMAT1 antibody
Product Images
Other products for "ZMAT1"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-ZMAT1 antibody: synthetic peptide directed towards the middle region of human ZMAT1. Synthetic peptide located within the following region: EASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDYIKVQKARGL |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 51 kDa |
| Database Link | |
| Background | The function of ZMAT1 has not been determined |
| Synonyms | KIAA1789; matrin type 1; MGC176597; MGC176728; OTTHUMP00000023703; zinc finger |
| Note | Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 86%; Mouse: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.