Rabbit Polyclonal anti-ZMAT1 antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ZMAT1 antibody: synthetic peptide directed towards the middle region of human ZMAT1. Synthetic peptide located within the following region: EASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDYIKVQKARGL |
Rabbit Polyclonal Anti-Zmat1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Immunogen | The immunogen for Anti-Zmat1 antibody is synthetic peptide directed towards the middle region of Mouse Zmat1. Synthetic peptide located within the following region: HNLPAESKTYDSFQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYR |
Rabbit Polyclonal Anti-ZMAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ZMAT1 antibody: synthetic peptide directed towards the middle region of human ZMAT1. Synthetic peptide located within the following region: RMCEQRFSHEASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDY |
Germany
Japan
United Kingdom
China