ZMAT1 Rabbit Polyclonal Antibody

CAT#: TA339774

Rabbit Polyclonal Anti-ZMAT1 Antibody

Product Images

WB Suggested Anti-ZMAT1 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZMAT1 antibody: synthetic peptide directed towards the middle region of human ZMAT1. Synthetic peptide located within the following region: RMCEQRFSHEASQTYQRPYHISPVESQLPQWLPTHSKRTYDSFQDELEDY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Database Link:
  NP_115817
  Entrez Gene 84460 Human
• Background: The function of ZMAT1 has not been determined.
• Synonyms: KIAA1789; matrin type 1; MGC176597; MGC176728; OTTHUMP00000023703; zinc finger
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%