Metabotropic Glutamate Receptor 6 (GRM6) Rabbit Polyclonal Antibody

CAT#: TA329686

Rabbit Polyclonal Anti-GRM6 Antibody

Product Images

WB Suggested Anti-GRM6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRM6 antibody: synthetic peptide directed towards the middle region of human GRM6. Synthetic peptide located within the following region: EFWEENFNCKLTSSGTQSDDSTRKCTGEERIGRDSTYEQEGKVQFVIDAV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: glutamate metabotropic receptor 6
• Database Link:
  NP_000834
  Entrez Gene 2916 Human
  UniProt ID O15303
• Background: GRM6 is the receptor for glutamate. The activity of this receptor is mediated by a G-protein that inhibits adenylate cyclase activity.L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities.
• Synonyms: CSNB1B; GPRC1F; mGlu6; MGLUR6
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Rabbit: 87%; Guinea pig: 87%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction