Grainyhead like protein 1 homolog Rabbit Polyclonal Antibody

CAT#: TA329693

Rabbit Polyclonal Anti-GRHL1 Antibody

Product Images

WB Suggested Anti-GRHL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRHL1 antibody: synthetic peptide directed towards the N terminal of human GRHL1. Synthetic peptide located within the following region: GENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTAPDTTVTVSIATMPTHSI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Database Link:
  NP_055367
  Entrez Gene 29841 Human
• Background: GRHL1 is a member of the grainyhead family of transcription factors. GRHL1 interacts with sister of mammalian grainyhead (SOM) and may function as a transcription factor during development. Two transcript variants encoding distinct isoforms have been identified for GRHL1.This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with sister of mammalian grainyhead (SOM) and may function as a transcription factor during development. Two transcript variants encoding distinct isoforms have been identified for this gene.
• Synonyms: grainyhead-like 1 (Drosophila); LBP-32; LBP32; LBP protein 32; leader-binding protein 32; mammalian grainyhead; MGR; TFCP2L2; transcription factor CP2-like 2
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Pig: 85%

Reference Data

• Protein Families: Transcription Factors, Transmembrane