HCLS1 Rabbit Polyclonal Antibody

CAT#: TA329699

Rabbit Polyclonal Anti-HCLS1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Other products for "HCLS1"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB, IHC
Reactivities Human, Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 54 kDa
Gene Name hematopoietic cell-specific Lyn substrate 1
Background HCLS1 is a substrate for caspase cleavage during apoptosis.
Synonyms CTTNL; HS1; lckBP1; p75
Note Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data
Protein Families Transcription Factors
Protein Pathways Pathogenic Escherichia coli infection, Tight junction

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.