HOXC4 Rabbit Polyclonal Antibody

CAT#: TA329715

Rabbit Polyclonal Anti-HOXC4 Antibody

Product Images

WB Suggested Anti-HOXC4 Antibody Titration: 2.0 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HOXC4 antibody: synthetic peptide directed towards the N terminal of human HOXC4. Synthetic peptide located within the following region: MIMSSYLMDSNYIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: homeobox C4
• Database Link:
  NP_705897
  Entrez Gene 15423 MouseEntrez Gene 3221 Human
  UniProt ID P09017
• Background: HOXC4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXC genes located in a cluster on chromosome 12. Three genes, HOXC5, HOXC4 and HOXC6, are co-transcribed in a primary transcript. Subsequent processing results in gene-specific transcripts, which sometimes share a 5' non-coding exon.
• Synonyms: cp19; HOX3; HOX3E
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors