CHX10 (VSX2) Rabbit Polyclonal Antibody

CAT#: TA329721

Rabbit Polyclonal Anti-CHX10 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "VSX2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CHX10 antibody: synthetic peptide directed towards the C terminal of human CHX10. Synthetic peptide located within the following region: ESILKSAKDGIMDSCAPWLLGMHKKSLEAAAESGRKPEGERQALPKLDKM
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name visual system homeobox 2
Background Human CHX10 is expressed in progenitor cells of the developing neuroretina and in the inner nuclear layer of the mature retina. The strong conservation in vertebrates of the CHX10 sequence, pattern of expression and loss-of-function phenotypes demonstrates the evolutionary importance of the genetic network through which this gene regulates eye development.
Synonyms CHX10; HOX10; MCOP2; MCOPCB3; RET1
Note Immunogen sequence homology: Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%; Dog: 85%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.