Ilf3 Rabbit Polyclonal Antibody

CAT#: TA329734

Rabbit Polyclonal Anti-Ilf3 Antibody

Product Images

WB Suggested Anti-Ilf3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Mouse Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Ilf3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YQGDSYNSPVPPKHAGKKPLHGGQQKASYSSGYQSHQGQQQPYNQSQYSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 98 kDa
• Gene Name: interleukin enhancer binding factor 3
• Database Link:
  NP_034691
  Entrez Gene 16201 Mouse
  UniProt ID Q9Z1X4
• Background: The function of Ilf3 remains unknown.
• Synonyms: CBTF; DRBF; DRBP76; MMP4; MPHOSPH4; MPP4; NF-AT-90; NF90; NF110; NFAR; NFAR-1; NFAR2; TCP80; TCP110
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Goat: 85%