SMAD4 Rabbit Polyclonal Antibody

CAT#: TA329742

Rabbit Polyclonal Anti-SMAD4 Antibody

Product Images

WB Suggested Anti-SMAD4 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

• 

  Sample Type: Human nuclear cell extracts (30 ug); Primary Dilution: 1:1000; Secondary Antibody: anti-Rabbit HRP; Secondary Dilution: 1:20000; Image Submitted By: Katarina Luciakova; Cancer Research Institute See Customer Feedback tab for detailed informat

• 

  SMAD4 antibody - middle region validated by WB using U2OS nuclear extracts

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMAD4 antibody: synthetic peptide directed towards the middle region of human SMAD4. Synthetic peptide located within the following region: NIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: SMAD family member 4
• Database Link:
  NP_005350
  Entrez Gene 4089 Human
  UniProt ID Q13485
• Background: SMAD4 is one of the Smad family members, which are essential intracellular signalling components of the transforming growth factor-beta (TGF-beta) superfamily. Smad2 and Smad3 are structurally highly similar and mediate TGF-beta signals. Smad4 is distantly related to Smads 2 and 3, and forms a heteromeric complex with Smad2 after TGF-beta or activin stimulation. TGF-beta induces heteromeric complexes of Smads 2, 3 and 4, and their concomitant translocation to the nucleus, which is required for efficient TGF-beta signal transduction
• Synonyms: DPC4; JIP; MADH4; MYHRS
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Mouse: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Adherens junction, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Pancreatic cancer, Pathways in cancer, TGF-beta signaling pathway, Wnt signaling pathway