NEUROD1 Rabbit Polyclonal Antibody

CAT#: TA329757

Rabbit Polyclonal Anti-NEUROD1 Antibody

Product Images

WB Suggested Anti-NEUROD1 Antibody Titration: 1.25ug/ml; ELISA Titer: 1:62500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NEUROD1 antibody: synthetic peptide directed towards the N terminal of human NEUROD1. Synthetic peptide located within the following region: MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: neuronal differentiation 1
• Database Link:
  NP_002491
  Entrez Gene 4760 Human
  UniProt ID Q13562
• Background: NeuroD1is a members of bHLH family that involves in neuroendocrine differentiation.
• Synonyms: BETA2; BHF-1; bHLHa3; MODY6; NEUROD
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young