DOK6 Rabbit Polyclonal Antibody

CAT#: TA329777

Rabbit polyclonal Anti-DOK6 Antibody

Product Images

WB Suggested Anti-DOK6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DOK6 antibody: synthetic peptide directed towards the middle region of human DOK6. Synthetic peptide located within the following region: IYSLQGHGFGSSKMSRAQTFPSYAPEQSEEAQQPLSRSSSYGFSYSSSLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: docking protein 6
• Database Link:
  NP_689934
  Entrez Gene 220164 Human
  UniProt ID Q6PKX4
• Background: DOK6 is a member of the DOK (see DOK1; MIM 602919) family of intracellular adaptors that play a role in the RET (MIM 164761) signaling cascade.
• Synonyms: DOK5L; HsT3226
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Guinea pig: 86%; Horse: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome