WWP2 Rabbit Polyclonal Antibody

CAT#: TA329808

Rabbit Polyclonal Anti-WWP2 Antibody

Product Images

WB Suggested Anti-WWP2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateWWP2 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Human kidney

• 

  Rabbit Anti-WWP2 Antibody;Paraffin Embedded Tissue: Human alveolar cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WWP2 antibody: synthetic peptide directed towards the middle region of human WWP2. Synthetic peptide located within the following region: EMKYTSEGVRYFVDHNTRTTTFKDPRPGFESGTKQGSPGAYDRSFRWKYH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 47 kDa
• Gene Name: WW domain containing E3 ubiquitin protein ligase 2
• Database Link:
  NP_955456
  Entrez Gene 11060 Human
  UniProt ID O00308
• Background: WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions.This gene encodes a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. The encoded protein contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Synonyms: AIP2; WWp2-like
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Zebrafish: 80%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis