WWP2 Rabbit Polyclonal Antibody

CAT#: TA329809

Rabbit Polyclonal Anti-WWP2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "WWP2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-WWP2 antibody: synthetic peptide directed towards the C terminal of human WWP2. Synthetic peptide located within the following region: IDKVGKETWLPRSHTCFNRLDLPPYKSYEQLREKLLYAIEETEGFGQE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 51 kDa
Gene Name WW domain containing E3 ubiquitin protein ligase 2
Background WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. This gene encodes a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. The encoded protein contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Synonyms AIP2; WWp2-like
Note Immunogen sequence homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome
Protein Pathways Ubiquitin mediated proteolysis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.