MYLIP Rabbit Polyclonal Antibody

CAT#: TA329831

Rabbit Polyclonal Anti-MYLIP Antibody

Product Images

WB Suggested Anti-MYLIP Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: SK-MEL-2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYLIP antibody: synthetic peptide directed towards the middle region of human MYLIP. Synthetic peptide located within the following region: CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: myosin regulatory light chain interacting protein
• Database Link:
  NP_037394
  Entrez Gene 29116 Human
  UniProt ID Q8WY64
• Background: The ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowthThe ERM protein family members ezrin, radixin, and moesin are cytoskeletal effector proteins linking actin to membrane-bound proteins at the cell surface. Myosin regulatory light chain interacting protein (MYLIP) is a novel ERM-like protein that interacts with myosin regulatory light chain and inhibits neurite outgrowth.
• Synonyms: IDOL; MIR
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome