SEMCAP3 (PDZRN3) Rabbit Polyclonal Antibody

CAT#: TA329848

Rabbit Polyclonal Anti-PDZRN3 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "PDZRN3"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PDZRN3 antibody is: synthetic peptide directed towards the N-terminal region of Human PDZRN3. Synthetic peptide located within the following region: ELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 80 kDa
Gene Name PDZ domain containing ring finger 3
Background PDZRN3 is a E3 ubiquitin-protein ligase. It plays an important role in regulating the surface level of MUSK on myotubes. It mediates the ubiquitination of MUSK, promoting its endocytosis and lysosomal degradation. It might contribute to terminal myogenic differentiation.
Synonyms LNX3; SEMACAP3; SEMCAP3
Note Immunogen sequence homology: Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.