RNF156 (MGRN1) Rabbit Polyclonal Antibody

CAT#: TA329849

Rabbit Polyclonal Anti-MGRN1 Antibody

Product Images

WB Suggested Anti-MGRN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: 721_B cell lysateMGRN1 is supported by BioGPS gene expression data to be expressed in 721_B

• 

  WB Suggested Anti-MGRN1 Antibody ; Positive Control: Lane 1: 10ug MGRN1-GFP transfected HEK293T Lane 2: 10ug mut1MGRN1-GFP transfected HEK293T Lane 3: 10ug mut1MGRN2-GFP transfected HEK293T Lane 4: 10ug GFP transfected HEK293T Lane 5: 10ug IP for GFP usin

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MGRN1 antibody: synthetic peptide directed towards the middle region of human MGRN1. Synthetic peptide located within the following region: EIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: mahogunin ring finger 1
• Database Link:
  NP_056061
  Entrez Gene 23295 Human
  UniProt ID O60291
• Background: Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro. [supplied by OMIM]
• Synonyms: RNF156
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Goat: 79%

Reference Data

• Protein Pathways: Ubiquitin mediated proteolysis