RNF125 Rabbit Polyclonal Antibody

CAT#: TA329868

Rabbit Polyclonal Anti-RNF125 Antibody


USD 375.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "RNF125"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RNF125 antibody: synthetic peptide directed towards the middle region of human RNF125. Synthetic peptide located within the following region: ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 26 kDa
Gene Name ring finger protein 125, E3 ubiquitin protein ligase
Background This gene encodes a novel E3 ubiquitin ligase that contains an N-terminal RING finger domain. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.
Synonyms TNORS; TRAC-1; TRAC1
Note Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome
Protein Pathways RIG-I-like receptor signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.