RNF125 Rabbit Polyclonal Antibody
Other products for "RNF125"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RNF125 antibody: synthetic peptide directed towards the middle region of human RNF125. Synthetic peptide located within the following region: ENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 26 kDa |
Gene Name | ring finger protein 125, E3 ubiquitin protein ligase |
Database Link | |
Background | This gene encodes a novel E3 ubiquitin ligase that contains an N-terminal RING finger domain. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway. |
Synonyms | TNORS; TRAC-1; TRAC1 |
Note | Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | RIG-I-like receptor signaling pathway |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.