Wnt1 Rabbit Polyclonal Antibody

CAT#: TA329905

Rabbit Polyclonal Anti-Wnt1 Antibody

Product Images

Host: Rabbit; Target Name: Wnt1; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Wnt1 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Wnt1. Synthetic peptide located within the following region: NFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: wingless-type MMTV integration site family, member 1
• Database Link:
  NP_067254
  Entrez Gene 22408 Mouse
  UniProt ID P04426
• Background: Wnt1 is a ligand for members of the frizzled family of seven transmembrane receptors. In some developmental processes, it is also a ligand for the coreceptor RYK, thus triggering Wnt signaling. It is a probable developmental protein and may be a signaling molecule important in CNS development. Wnt1 is likely to signal over only few cell diameters. It ha s a proeminent role in the induction of the mesencephalon and cerebellum. It may play a crucial role in the morphogenesis of the neural tube and/or the early stages of CNS development. It has a role in osteoblast function and bone development.
• Synonyms: INT1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%