Foxp4 Rabbit Polyclonal Antibody

CAT#: TA329952

Rabbit Polyclonal Anti-FOXP4 Antibody

Product Images

WB Suggested Anti-FOXP4 Antibody Titration: 1.25ug/ml; ELISA Titer: 1:1562500; Positive Control: SP2/0 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXP4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QEDLGVPGEPLPSNGSSSPPRLSPPQYSHQIQVKEEPAEAEEDRRPGPPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 87 kDa
• Gene Name: forkhead box P4
• Database Link:
  NP_083043
  Entrez Gene 74123 Mouse
  UniProt ID Q9DBY0
• Background: Foxp4 is a member of the murine forkhead family of transcription factors. It is expressed exclusively in the epithelial cells of the developing intestine, where, in late development, it is expressed in a gradient along the longitudinal axis of the villi.
• Synonyms: FKHLA; FLJ40908; FLJ44184; hFKHLA; OTTHUMP00000043536
• Note: Immunogen sequence homology: Rat: 100%; Horse: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 85%