Nr5a2 Rabbit Polyclonal Antibody
Other products for "Nr5a2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Nr5a2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LDYTVCNYPQQTEKFGQLLLRLPEIRAISKQAEDYLYYKHVNGDVPYNNL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 64 kDa |
Gene Name | nuclear receptor subfamily 5, group A, member 2 |
Database Link | |
Background | Nr5a2 binds to promoters containing the sequence element 5'-AACGACCGACCTTGAG-3'.Nr5a2 plays a role in the regulation of gene expression in liver and pancreas. Nr5a2 may play a role in embryonic development. |
Synonyms | B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta; hB1F; hB1F-2; LRH-1; LRH1 |
Note | Immunogen sequence homology: Rat: 100%; Mouse: 100%; Zebrafish: 83%; Dog: 79%; Pig: 79%; Horse: 79%; Human: 79%; Sheep: 79%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.