Ces2a Rabbit Polyclonal Antibody

CAT#: TA329985

Rabbit Polyclonal Anti-CES6 Antibody

Product Images

WB Suggested Anti-CES6 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:312500; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CES6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MQSGVALLPDLISDTSEVVYKTVANLSGCEATDSEALIHCLRAKSKQEIL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: carboxylesterase 2A
• Database Link:
  NP_598721
  Entrez Gene 102022 Mouse
  UniProt ID Q8QZR3
• Background: Mouse Ces6 is a member of carboxylesterases family. Carboxylesterases are enzymes that catalyze the hydrolysis of a wide range of ester-containing endogenous and xenobiotic compounds.
• Synonyms: 9130231C15Rik; AI266984; Ces6
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%