Nr5a1 Rabbit Polyclonal Antibody

CAT#: TA329987

Rabbit Polyclonal Anti-NR5A1 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "Nr5a1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NR5A1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QLHALQLDRQEFVCLKFLILFSLDVKFLNNHSLVKDAQEKANAALLDYTL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 51 kDa
Gene Name nuclear receptor subfamily 5, group A, member 1
Background NR5A1 is an important regulator of steroidogeneisis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300.
Synonyms AD4BP; ELP; FTZ1; FTZF1; POF7; SF-1; SF1; STF-1
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Human: 93%; Sheep: 93%; Bovine: 93%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.