GDI1 Rabbit Polyclonal Antibody

CAT#: TA330010

Rabbit Polyclonal Anti-GDI1 Antibody

Product Images

Human, Mouse

• 

  WB Suggested Anti-GDI1 Antibody Titration: 1.25ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GDI1 antibody: synthetic peptide directed towards the C terminal of human GDI1. Synthetic peptide located within the following region: VFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: GDP dissociation inhibitor 1
• Database Link:
  NP_001484
  Entrez Gene 14567 MouseEntrez Gene 2664 Human
  UniProt ID P31150
• Background: GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI1 is expressed primarily in neural and sensory tissues. Mutations in GDI1 have been linked to X-linked nonspecific mental retardation.
• Synonyms: 1A; GDIL; MRX41; MRX48; OPHN2; RABGD1A; RABGDIA; XAP-4
• Note: Immunogen sequence homology: Human: 100%; Guinea pig: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Sheep: 92%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome