Thyrotropin Releasing Hormone (TRH) Rabbit Polyclonal Antibody

CAT#: TA330017

Rabbit Polyclonal Anti-TRH Antibody

Product Images

WB Suggested Anti-TRH Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRH antibody: synthetic peptide directed towards the C terminal of human TRH. Synthetic peptide located within the following region: RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: thyrotropin releasing hormone
• Database Link:
  NP_009048
  Entrez Gene 7200 Human
  UniProt ID P20396
• Background: TRH functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.
• Synonyms: Pro-TRH; TRF
• Note: Immunogen sequence homology: Bovine: 100%; Human: 100%; Zebrafish: 92%; Guinea pig: 84%; Chicken: 78%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein