MMP2 Rabbit Polyclonal Antibody

CAT#: TA330021

Rabbit Polyclonal Anti-MMP2 Antibody

Product Images

Lanes: Lane 1: 15ug MDA-MB-231 lysate; Lane 2: 15ug MCF7 lysate; Primary Antibody Dilution: 1:1000; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: 1:10,000; Gene Name: MMP2; Submitted by: Katarzyna Augoff, University of Wroclaw;

• 

  MMP1 in connective tissue in overian carcinoma was detected using HRP/DAB brown color stain. Recommended for IHC on human tissue. Working dilution 2-10 ug/mL

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: matrix metallopeptidase 2
• Database Link:
  NP_004521
  Entrez Gene 4313 Human
  UniProt ID P08253
• Background: MMP-2 is involved in the cleavage of gelatin type I and collagen types IV, V, VII, X.
• Synonyms: CLG4; CLG4A; MMP-2; MMP-II; MONA; TBE-1
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Bladder cancer, GnRH signaling pathway, Leukocyte transendothelial migration, Pathways in cancer