SREBP2 (SREBF2) Rabbit Polyclonal Antibody

CAT#: TA330045

Rabbit Polyclonal Anti-SREBF2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "SREBF2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2. Synthetic peptide located within the following region: VMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIEL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 74 kDa
Gene Name sterol regulatory element binding transcription factor 2
Background SREBF2 encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain.
Synonyms bHLHd2; SREBP-2; SREBP2
Note Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rat: 100%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.