SREBP2 (SREBF2) Rabbit Polyclonal Antibody

CAT#: TA330045

Rabbit Polyclonal Anti-SREBF2 Antibody

Product Images

WB Suggested Anti-SREBF2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:7812500; Positive Control: Transfected 293TSREBF2 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SREBF2 antibody: synthetic peptide directed towards the middle region of human SREBF2. Synthetic peptide located within the following region: VMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 74 kDa
• Gene Name: sterol regulatory element binding transcription factor 2
• Database Link:
  NP_004590
  Entrez Gene 6721 Human
  UniProt ID Q12772
• Background: SREBF2 encodes a ubiquitously expressed transcription factor that controls cholesterol homeostasis by stimulating transcription of sterol-regulated genes. The encoded protein contains a basic helix-loop-helix-leucine zipper (bHLH-Zip) domain.
• Synonyms: bHLHd2; SREBP-2; SREBP2
• Note: Immunogen sequence homology: Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rat: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors