TCF4 Rabbit Polyclonal Antibody

CAT#: TA330065

Rabbit Polyclonal Anti-TCF4 Antibody

Product Images

WB Suggested Anti-TCF4 Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Placenta

• 

  Host: Rabbit; Target Name: TCF4; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TCF4 antibody: synthetic peptide directed towards the N terminal of human TCF4. Synthetic peptide located within the following region: MHHQQRMAALGTDKELSDLLDFSAMFSPPVSSGKNGPTSLASGHFTGSNV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 71 kDa
• Gene Name: transcription factor 4
• Database Link:
  NP_003190
  Entrez Gene 6925 Human
  UniProt ID P15884
• Background: TCF4 encodes transcription factor 4, a basic helix-turn-helix transcription factor. The protein recognizes an Ephrussi-box ('E-box') binding site ('CANNTG') - a motif first identified in immunoglobulin enhancers. TCF4 is expressed predominantly in pre-B-cells, although it is found in other tissues as well.
• Synonyms: bHLHb19; E2-2; FECD3; ITF-2; ITF2; PTHS; SEF-2; SEF2; SEF2-1; SEF2-1A; SEF2-1B; SEF2-1D; TCF-4
• Note: Immunogen sequence homology: Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors