Nuclear Factor Erythroid 2 Related Factor 1 (NFE2L1) Rabbit Polyclonal Antibody

CAT#: TA330067

Rabbit Polyclonal Anti-NFE2L1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "NFE2L1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen Synthetic peptide directed towards the middle region of human NFE2L1. Synthetic peptide located within the following region: HTYNMAPSALDSADLPPPSALKKGSKEKQADFLDKQMSRDEHRARAMKIP
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 85 kDa
Gene Name nuclear factor, erythroid 2 like 1
Background NFE2L1 activates erythroid-specific, globin gene expression. This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases due to the shared symbol of NRF1 for this gene, NFE2L1, and for 'nuclear respiratory factor 1' which has an official symbol of NRF1. Sequence Note: The RefSeq transcript and protein were derived from transcript and genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-256 DB097304.1 1-256 257-603 DA230932.1 224-570 604-1464 AK090459.1 569-1429 1465-3372 U08853.1 199-2106 3373-4349 AC004477.2 104176-105152 4350-4891 BM983473.1 1-542 c
Synonyms LCR-F1; NRF1; TCF11
Note Immunogen sequence homology: Mouse:100%; Bovine:100%; Rat:100%; Dog:100%; Human:100%; Sumatran orangutan:92%
Reference Data
Protein Families Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.