EVX1 Rabbit Polyclonal Antibody

CAT#: TA330088

Rabbit Polyclonal Anti-EVX1 Antibody

Product Images

WB Suggested Anti-EVX1 Antibody Titration: 1.0-2.0ug/ml; Positive Control: Jurkat cell lysate

• 

  Human kidney

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EVX1 antibody: synthetic peptide directed towards the N terminal of human EVX1. Synthetic peptide located within the following region: AGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFYEEI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: even-skipped homeobox 1
• Database Link:
  NP_001980
  Entrez Gene 2128 Human
  UniProt ID P49640
• Background: EVX1 is a member of the vertebrate eve-related homeo box family. This protein acts as a transcriptional repressor. A similar protein in mice is critical for early embryogenesis.
• Synonyms: EVX-1
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 91%

Reference Data

• Protein Families: ES Cell Differentiation/IPS