HLX1 (HLX) Rabbit Polyclonal Antibody

CAT#: TA330095

Rabbit Polyclonal Anti-HLX Antibody

Product Images

WB Suggested Anti-HLX1 Antibody Titration: 1ug/ml; Positive Control: HepG2 cell lysate

• 

  Sample Type: Xenopus Laevis embryo stage 46 gut tissue Primary Dilution: 1:200

Specifications

Product Data

• Applications: IF, WB
• Recommended Dilution: WB, IF
• Reactivities: Human, Xenopus
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HLX1 antibody: synthetic peptide directed towards the middle region of human HLX1 (Cat# AAP31195). Synthetic peptide located within the following region: PGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKYVTKPDR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: H2.0 like homeobox
• Database Link:
  NP_068777
  Entrez Gene 3142 Human
  UniProt ID Q14774
• Background: H2.0-like homeo box 1; H2.0 (Drosophilia)-like homeo box-1.
• Synonyms: HB24; HLX1
• Note: Immunogen sequence homology: Zebrafish: 92%

Reference Data

• Protein Families: Transcription Factors