TEF1 (TEAD1) Rabbit Polyclonal Antibody

CAT#: TA330118

Rabbit Polyclonal Anti-TEAD1 Antibody

Product Images

WB Suggested Anti-TEAD1 Antibody Titration: 2.5ug/ml; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TEAD1 antibody: synthetic peptide directed towards the N terminal of human TEAD1. Synthetic peptide located within the following region: MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: TEA domain transcription factor 1
• Database Link:
  NP_068780
  Entrez Gene 7003 Human
  UniProt ID P28347
• Background: This gene encodes a ubiquitous transcriptional enhancer factor that is a member of the TEA/ATTS domain family. This protein directs the transactivation of a wide variety of genes and, in placental cells, also acts as a transcriptional repressor. Mutations in this gene cause Sveinsson's chorioretinal atrophy. Additional transcript variants have been described but their full-length natures have not been experimentally verified. [provided by RefSeq, May 2010]
• Synonyms: AA; NTEF-1; REF1; TCF-13; TCF13; TEAD-1; TEF-1
• Note: Immunogen sequence homology: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%; Chicken: 85%

Reference Data

• Protein Families: Transcription Factors