DBPA (YBX3) Rabbit Polyclonal Antibody

CAT#: TA330134

Rabbit Polyclonal Anti-YBX3 Antibody

Product Images

Host: Rabbit; Target Name: CSDA; Sample Tissue: 239T lysates; Antibody Dilution: 1.0ug/ml; YBX3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CSDA antibody: synthetic peptide directed towards the C terminal of human CSDA. Synthetic peptide located within the following region: GPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: Y-box binding protein 3
• Database Link:
  NP_003642
  Entrez Gene 8531 Human
  UniProt ID P16989
• Background: Human DNA-binding protein (dbpA) is a member of a Y-box binding protein family containing a cold shock domain. The increased expression of Y box binding proteins in somatic cells is associated with cell proliferation and transformation.
• Synonyms: CSDA; CSDA1; DBPA; ZONAB
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Guinea pig: 91%; Mouse: 91%; Rat: 91%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Tight junction