MAX Rabbit Polyclonal Antibody

CAT#: TA330150

Rabbit Polyclonal Anti-MAX Antibody

Product Images

WB Suggested Anti-MAX Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: COLO205 cell lysateThere is BioGPS gene expression data showing that MAX is expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAX antibody: synthetic peptide directed towards the n terminal of human MAX. Synthetic peptide located within the following region: MSDNDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: MYC associated factor X
• Database Link:
  NP_660087
  Entrez Gene 4149 Human
  UniProt ID P61244
• Background: MAX is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation.The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Multiple alternatively spliced transcript variants have been described for this gene but the full length nature for some of them is unknown. The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Multiple alternatively spliced transcript variants have been described for this gene but the full-length nature for some of them is unknown.
• Synonyms: bHLHd4
• Note: Immunogen sequence homology: African clawed frog: 100%; Chicken: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: MAPK signaling pathway, Pathways in cancer, Small cell lung cancer