PC4 (SUB1) Rabbit Polyclonal Antibody

CAT#: TA330154

Rabbit Polyclonal Anti-SUB1 Antibody

Product Images

WB Suggested Anti-PC4 Antibody Titration: 2.5ug/ml; Positive Control: Raji cell lysateThere is BioGPS gene expression data showing that SUB1 is expressed in Raji

• 

  Human Lung

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PC4 antibody: synthetic peptide directed towards the N terminal of human PC4. Synthetic peptide located within the following region: MPKSKELVSSGSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: SUB1 homolog, transcriptional regulator
• Database Link:
  NP_006704
  Entrez Gene 10923 Human
  UniProt ID P53999
• Background: PC4 is a transcriptional coactivator. General transcription factor IIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity rather than by reducing the repressive activity of PC4 via its phosphorylation
• Synonyms: p14; P15; PC4
• Note: Immunogen sequence homology: Bovine:100%; Human:100%; Sumatran orangutan:100%; Crab-eating macaque:100%; Dog:100%; Rat:92%; Mouse:91%; Chicken:85%; Zebra finch:84%; Body louse:78%

Reference Data

• Protein Families: Transcription Factors