KLF3 Rabbit Polyclonal Antibody

CAT#: TA330189

Rabbit Polyclonal Anti-KLF3 Antibody

Product Images

WB Suggested Anti-KLF3 Antibody Titration: 1.25ug/ml; Positive Control: HepG2 cell lysateKLF3 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLF3 antibody: synthetic peptide directed towards the N terminal of human KLF3. Synthetic peptide located within the following region: LSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: Kruppel-like factor 3 (basic)
• Database Link:
  NP_057615
  Entrez Gene 51274 Human
  UniProt ID P57682
• Background: KLF3 is a zinc finger transcription factor that is known to function as a potent transcriptional repressor
• Synonyms: BKLF
• Note: Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 92%; Mouse: 86%

Reference Data

• Protein Families: Transcription Factors