KLF3 Rabbit Polyclonal Antibody

CAT#: TA330190

Rabbit Polyclonal Anti-KLF3 Antibody

Product Images

Host: Rabbit; Target Name: KLF3; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KLF3 antibody is: synthetic peptide directed towards the C-terminal region of Human KLF3. Synthetic peptide located within the following region: SHLQQPLMVSLSEEMENSSSSMQVPVIESYEKPISQKKIKIEPGIEPQRT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: Kruppel-like factor 3 (basic)
• Database Link:
  NP_057615
  Entrez Gene 51274 Human
  UniProt ID P57682
• Background: KLF3 binds to the CACCC box of erythroid cell-expressed genes and may play a role in hematopoiesis.
• Synonyms: BKLF
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors