OSR1 Rabbit Polyclonal Antibody

CAT#: TA330208

Rabbit Polyclonal Anti-OSR1 Antibody

Product Images

Host: Rabbit; Target Name: OSR1; Sample Tissue: Thymus Tumor lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-OSR1 antibody is: synthetic peptide directed towards the N-terminal region of Human OSR1. Synthetic peptide located within the following region: PIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 29 kDa
• Gene Name: odd-skipped related transciption factor 1
• Database Link:
  NP_660303
  Entrez Gene 130497 Human
  UniProt ID Q8TAX0
• Background: OSR1 is a transcription factor that plays a role in the regulation of embryonic heart and urogenital development.
• Synonyms: ODD
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%