Atf6 Rabbit Polyclonal Antibody

CAT#: TA330233

Rabbit Polyclonal Anti-Atf6 Antibody

Product Images

WB Suggested Anti-Atf6 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Mouse Heart

• 

  Mouse adipose

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Atf6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QIDCQVMDTRILHIKSSSVPPYLRDHQRNQTSTFFGSPPTTTETTHVVST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 72 kDa
• Gene Name: activating transcription factor 6
• Database Link:
  NP_001074773
  Entrez Gene 226641 Mouse
  UniProt ID F6VAN0
• Background: The function of Atf6 remains unknown.
• Synonyms: ATF6-alpha; ATF6A
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 92%; Mouse: 85%